PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27925.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 192aa    MW: 21612.9 Da    PI: 7.4132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27925.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM45.62.3e-14408484128
        NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                katg+   v+s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  PK27925.2  40 KATGSPSYVYSSDNRVIGVKKTMVFYKGKAPTGRKTKWKMNEYRA 84 
                89*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100515.7971111IPR003441NAC domain
SuperFamilySSF1019416.15E-1640109IPR003441NAC domain
PfamPF023652.2E-54383IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
SIQVSCVREI LSSGSSLHQD KKEKLEGVDP IVLQLPDIXK ATGSPSYVYS SDNRVIGVKK  60
TMVFYKGKAP TGRKTKWKMN EYRAIEEVNT SNNITTPTLR HEFSLCRVYI ISGSFRAFDR  120
RPTESTRVIQ EQQRDEAGPS NQNAAMIERA QSSSATSSSG ELVDNPMAGG SSTDWEMNQQ  180
PLWDLWEQFN WP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872891.14e-65PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR33e-41NAC90_ARATH; NAC domain-containing protein 90
TrEMBLW9RGY63e-61W9RGY6_9R
STRINGGLYMA12G31150.13e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.24e-42NAC domain containing protein 61